SCOPe 2.08: Domain d4h13g_: 4h13 G:

Lineage for d4h13g_ (4h13 G:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.26: PetG subunit of the cytochrome b6f complex [103446] (1 family)

5. Family f.23.26.1: PetG subunit of the cytochrome b6f complex [103447] (2 proteins)

6. Protein automated matches [196847] (1 species)
   not a true protein

7. Species Mastigocladus laminosus [TaxId:83541] [196848] (5 PDB entries)

8. Domain d4h13g_: 4h13 G: [252360]
   Other proteins in same PDB: d4h13a_, d4h13b_, d4h13d1, d4h13d2, d4h13f_, d4h13h_
   automated match to d4i7zg_
   complexed with 7ph, 8k6, bcr, cd, cla, fes, hem, mys, oct, opc, sqd, tds, umq

Details for d4h13g_

PDB Entry: 4h13, 3.07 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex from Mastigocladus laminosus with TDS

PDB Compounds: (G:) Cytochrome b6-f complex subunit 5

SCOPe Domain Sequences for d4h13g_:

Sequence; same for both SEQRES and ATOM records:

>d4h13g_ f.23.26.1 (G:) automated matches {Mastigocladus laminosus [TaxId: 83541]}
mveplldglvlglvfatlgglfyaayqqykrpnelgg

Timeline for d4h13g_:

• d4h13g_ first appeared in SCOPe 2.04
  
• d4h13g_ appears in SCOPe 2.07