Lineage for d4h13g_ (4h13 G:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2579107Superfamily f.23.26: PetG subunit of the cytochrome b6f complex [103446] (1 family) (S)
  5. 2579108Family f.23.26.1: PetG subunit of the cytochrome b6f complex [103447] (2 proteins)
  6. 2579119Protein automated matches [196847] (1 species)
    not a true protein
  7. 2579120Species Mastigocladus laminosus [TaxId:83541] [196848] (5 PDB entries)
  8. 2579122Domain d4h13g_: 4h13 G: [252360]
    Other proteins in same PDB: d4h13a_, d4h13b_, d4h13d1, d4h13d2, d4h13f_, d4h13h_
    automated match to d4i7zg_
    complexed with 7ph, 8k6, bcr, cd, cla, fes, hem, mys, oct, opc, sqd, tds, umq

Details for d4h13g_

PDB Entry: 4h13 (more details), 3.07 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex from Mastigocladus laminosus with TDS
PDB Compounds: (G:) Cytochrome b6-f complex subunit 5

SCOPe Domain Sequences for d4h13g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h13g_ f.23.26.1 (G:) automated matches {Mastigocladus laminosus [TaxId: 83541]}
mveplldglvlglvfatlgglfyaayqqykrpnelgg

SCOPe Domain Coordinates for d4h13g_:

Click to download the PDB-style file with coordinates for d4h13g_.
(The format of our PDB-style files is described here.)

Timeline for d4h13g_: