Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.26: PetG subunit of the cytochrome b6f complex [103446] (1 family) |
Family f.23.26.1: PetG subunit of the cytochrome b6f complex [103447] (2 proteins) |
Protein automated matches [196847] (1 species) not a true protein |
Species Mastigocladus laminosus [TaxId:83541] [196848] (5 PDB entries) |
Domain d4h13g_: 4h13 G: [252360] Other proteins in same PDB: d4h13a_, d4h13b_, d4h13d1, d4h13d2, d4h13f_, d4h13h_ automated match to d4i7zg_ complexed with 7ph, 8k6, bcr, cd, cla, fes, hem, mys, oct, opc, sqd, tds, umq |
PDB Entry: 4h13 (more details), 3.07 Å
SCOPe Domain Sequences for d4h13g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h13g_ f.23.26.1 (G:) automated matches {Mastigocladus laminosus [TaxId: 83541]} mveplldglvlglvfatlgglfyaayqqykrpnelgg
Timeline for d4h13g_: