SCOPe 2.06: Domain d4h13f_: 4h13 F:

Lineage for d4h13f_ (4h13 F:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family)

5. Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (2 proteins)

6. Protein PetM subunit of the cytochrome b6f complex [103443] (2 species)

7. Species Mastigocladus laminosus [TaxId:83541] [103444] (9 PDB entries)

8. Domain d4h13f_: 4h13 F: [252359]
   Other proteins in same PDB: d4h13a_, d4h13b_, d4h13d1, d4h13d2, d4h13g_, d4h13h_
   automated match to d1vf5s_
   complexed with 7ph, 8k6, bcr, cd, cla, fes, hem, mys, oct, opc, sqd, tds, umq

Details for d4h13f_

PDB Entry: 4h13, 3.07 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex from Mastigocladus laminosus with TDS

PDB Compounds: (F:) Cytochrome b6-f complex subunit 7

SCOPe Domain Sequences for d4h13f_:

Sequence; same for both SEQRES and ATOM records:

>d4h13f_ f.23.25.1 (F:) PetM subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
teemlyaallsfglifvgwglgvlllkiqga

Timeline for d4h13f_:

• d4h13f_ first appeared in SCOPe 2.04
  
• d4h13f_ appears in SCOPe 2.05
  
• d4h13f_ appears in SCOPe 2.07
  
• d4h13f_ appears in the current release, SCOPe 2.08