Lineage for d4h13f_ (4h13 F:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2579085Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family) (S)
  5. 2579086Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (2 proteins)
  6. 2579087Protein PetM subunit of the cytochrome b6f complex [103443] (2 species)
  7. 2579090Species Mastigocladus laminosus [TaxId:83541] [103444] (9 PDB entries)
  8. 2579092Domain d4h13f_: 4h13 F: [252359]
    Other proteins in same PDB: d4h13a_, d4h13b_, d4h13d1, d4h13d2, d4h13g_, d4h13h_
    automated match to d1vf5s_
    complexed with 7ph, 8k6, bcr, cd, cla, fes, hem, mys, oct, opc, sqd, tds, umq

Details for d4h13f_

PDB Entry: 4h13 (more details), 3.07 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex from Mastigocladus laminosus with TDS
PDB Compounds: (F:) Cytochrome b6-f complex subunit 7

SCOPe Domain Sequences for d4h13f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h13f_ f.23.25.1 (F:) PetM subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
teemlyaallsfglifvgwglgvlllkiqga

SCOPe Domain Coordinates for d4h13f_:

Click to download the PDB-style file with coordinates for d4h13f_.
(The format of our PDB-style files is described here.)

Timeline for d4h13f_: