SCOPe 2.08: Domain d4h13d2: 4h13 D:46-179

Lineage for d4h13d2 (4h13 D:46-179)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)

6. Protein automated matches [190874] (7 species)
   not a true protein

7. Species Mastigocladus laminosus [TaxId:83541] [255132] (4 PDB entries)

8. Domain d4h13d2: 4h13 D:46-179 [252358]
   Other proteins in same PDB: d4h13a_, d4h13b_, d4h13d1, d4h13f_, d4h13g_, d4h13h_
   automated match to d1vf5d1
   complexed with 7ph, 8k6, bcr, cd, cla, fes, hem, mys, oct, opc, sqd, tds, umq

Details for d4h13d2

PDB Entry: 4h13, 3.07 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex from Mastigocladus laminosus with TDS

PDB Compounds: (D:) Cytochrome b6-f complex iron-sulfur subunit

SCOPe Domain Sequences for d4h13d2:

Sequence, based on SEQRES records:

>d4h13d2 b.33.1.1 (D:46-179) automated matches {Mastigocladus laminosus [TaxId: 83541]}
sggavgggttakdklgnnvkvskfleshnagdrvlvqglkgdptyivveskeairdygin
avcthlgcvvpwnaaenkfkcpchgsqydetgkvirgpaplslalchatvqddnivltpw
tetdfrtgekpwwv

Sequence, based on observed residues (ATOM records):

>d4h13d2 b.33.1.1 (D:46-179) automated matches {Mastigocladus laminosus [TaxId: 83541]}
sggavttakdklgnnvkvskfleshnagdrvlvqglkgdptyivveskeairdyginavc
thlgcvvpwnaaenkfkcpchgsqydetgkvirgpaplslalchatvqddnivltpwtet
dfrtgekpwwv

Timeline for d4h13d2:

• d4h13d2 first appeared in SCOPe 2.04
  
• d4h13d2 appears in SCOPe 2.07