SCOPe 2.08: Domain d4h13d1: 4h13 D:9-45

Lineage for d4h13d1 (4h13 D:9-45)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families)

5. Family f.23.12.0: automated matches [254198] (1 protein)
   not a true family

6. Protein automated matches [254432] (4 species)
   not a true protein

7. Species Mastigocladus laminosus [TaxId:83541] [255131] (4 PDB entries)

8. Domain d4h13d1: 4h13 D:9-45 [252357]
   Other proteins in same PDB: d4h13a_, d4h13b_, d4h13d2, d4h13f_, d4h13g_, d4h13h_
   automated match to d2e76d2
   complexed with 7ph, 8k6, bcr, cd, cla, fes, hem, mys, oct, opc, sqd, tds, umq

Details for d4h13d1

PDB Entry: 4h13, 3.07 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex from Mastigocladus laminosus with TDS

PDB Compounds: (D:) Cytochrome b6-f complex iron-sulfur subunit

SCOPe Domain Sequences for d4h13d1:

Sequence; same for both SEQRES and ATOM records:

>d4h13d1 f.23.12.0 (D:9-45) automated matches {Mastigocladus laminosus [TaxId: 83541]}
dvpdmgrrqfmnllafgtvtgvalgalyplvkyfipp

Timeline for d4h13d1:

• d4h13d1 first appeared in SCOPe 2.04
  
• d4h13d1 appears in SCOPe 2.07