Lineage for d4h13b_ (4h13 B:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027980Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 3027981Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 3027982Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 3028029Protein Subunit IV of the cytochrome b6f complex [103495] (2 species)
  7. 3028032Species Mastigocladus laminosus [TaxId:83541] [103496] (8 PDB entries)
  8. 3028035Domain d4h13b_: 4h13 B: [252356]
    Other proteins in same PDB: d4h13a_, d4h13d1, d4h13d2, d4h13f_, d4h13g_, d4h13h_
    automated match to d2e74b1
    complexed with 7ph, 8k6, bcr, cd, cla, fes, hem, mys, oct, opc, sqd, tds, umq

Details for d4h13b_

PDB Entry: 4h13 (more details), 3.07 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex from Mastigocladus laminosus with TDS
PDB Compounds: (B:) Cytochrome b6-f complex subunit 4

SCOPe Domain Sequences for d4h13b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h13b_ f.32.1.1 (B:) Subunit IV of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
matlkkpdlsdpklraklakgmghnyygepawpndllyvfpvvimgtfacivalsvldpa
mvgepadpfatpleilpewylypvfqilrsvpnkllgvllmasvplglilvpfienvnkf
qnpfrrpvattiflfgtlvtiwlgigatfpldktltlglf

SCOPe Domain Coordinates for d4h13b_:

Click to download the PDB-style file with coordinates for d4h13b_.
(The format of our PDB-style files is described here.)

Timeline for d4h13b_: