![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
![]() | Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) ![]() Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
![]() | Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
![]() | Protein automated matches [196844] (6 species) not a true protein |
![]() | Species Mastigocladus laminosus [TaxId:83541] [196845] (4 PDB entries) |
![]() | Domain d4h13a_: 4h13 A: [252355] Other proteins in same PDB: d4h13b_, d4h13d1, d4h13d2, d4h13f_, d4h13g_, d4h13h_ automated match to d4i7za_ complexed with 7ph, 8k6, bcr, cd, cla, fes, hem, mys, oct, opc, sqd, tds, umq |
PDB Entry: 4h13 (more details), 3.07 Å
SCOPe Domain Sequences for d4h13a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h13a_ f.21.1.2 (A:) automated matches {Mastigocladus laminosus [TaxId: 83541]} manvydwfqerleiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykp tvteayasvqyimnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwis gvilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatl tryysahtfvlpwliavfmllhflmirkqgisgpl
Timeline for d4h13a_: