Lineage for d4h13a_ (4h13 A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577736Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 2577737Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 2577743Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 2577799Protein automated matches [196844] (6 species)
    not a true protein
  7. 2577813Species Mastigocladus laminosus [TaxId:83541] [196845] (5 PDB entries)
  8. 2577815Domain d4h13a_: 4h13 A: [252355]
    Other proteins in same PDB: d4h13b_, d4h13d1, d4h13d2, d4h13f_, d4h13g_, d4h13h_
    automated match to d4i7za_
    complexed with 7ph, 8k6, bcr, cd, cla, fes, hem, mys, oct, opc, sqd, tds, umq

Details for d4h13a_

PDB Entry: 4h13 (more details), 3.07 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex from Mastigocladus laminosus with TDS
PDB Compounds: (A:) Cytochrome b6

SCOPe Domain Sequences for d4h13a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h13a_ f.21.1.2 (A:) automated matches {Mastigocladus laminosus [TaxId: 83541]}
manvydwfqerleiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykp
tvteayasvqyimnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwis
gvilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatl
tryysahtfvlpwliavfmllhflmirkqgisgpl

SCOPe Domain Coordinates for d4h13a_:

Click to download the PDB-style file with coordinates for d4h13a_.
(The format of our PDB-style files is described here.)

Timeline for d4h13a_: