SCOPe 2.08: Domain d4h13a_: 4h13 A:

Lineage for d4h13a_ (4h13 A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families)
   Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically

5. Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
   a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein automated matches [196844] (6 species)
   not a true protein

7. Species Mastigocladus laminosus [TaxId:83541] [196845] (5 PDB entries)

8. Domain d4h13a_: 4h13 A: [252355]
   Other proteins in same PDB: d4h13b_, d4h13d1, d4h13d2, d4h13f_, d4h13g_, d4h13h_
   automated match to d4i7za_
   complexed with 7ph, 8k6, bcr, cd, cla, fes, hem, mys, oct, opc, sqd, tds, umq

Details for d4h13a_

PDB Entry: 4h13, 3.07 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex from Mastigocladus laminosus with TDS

PDB Compounds: (A:) Cytochrome b6

SCOPe Domain Sequences for d4h13a_:

Sequence; same for both SEQRES and ATOM records:

>d4h13a_ f.21.1.2 (A:) automated matches {Mastigocladus laminosus [TaxId: 83541]}
manvydwfqerleiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykp
tvteayasvqyimnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwis
gvilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatl
tryysahtfvlpwliavfmllhflmirkqgisgpl

Timeline for d4h13a_:

• d4h13a_ first appeared in SCOPe 2.04
  
• d4h13a_ appears in SCOPe 2.07