SCOPe 2.04: Domain d4h0cb_: 4h0c B:

Lineage for d4h0cb_ (4h0c B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (56 species)
   not a true protein

7. Species Dyadobacter fermentans [TaxId:471854] [256280] (1 PDB entry)

8. Domain d4h0cb_: 4h0c B: [252354]
   automated match to d3u0va_
   complexed with cit, gol, na

Details for d4h0cb_

PDB Entry: 4h0c, 1.62 Å

PDB Description: Crystal structure of phospholipase/Carboxylesterase from Dyadobacter fermentans DSM 18053

PDB Compounds: (B:) Phospholipase/Carboxylesterase

SCOPe Domain Sequences for d4h0cb_:

Sequence; same for both SEQRES and ATOM records:

>d4h0cb_ c.69.1.0 (B:) automated matches {Dyadobacter fermentans [TaxId: 471854]}
namythskqiitsgvpvqrakkavvmlhgrggtaadiislqkvlkldemaiyapqatnns
wypysfmapvqqnqpaldsalalvgevvaeieaqgipaeqiyfagfsqgacltleyttrn
arkyggiiaftggligqelaignykgdfkqtpvfistgnpdphvpvsrvqesvtiledmn
aavsqvvypgrphtisgdeiqlvnntilk

Timeline for d4h0cb_:

• d4h0cb_ is new in SCOPe 2.04-stable
  
• d4h0cb_ appears in SCOPe 2.05
  
• d4h0cb_ appears in the current release, SCOPe 2.08, called d4h0cb1