Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (124 species) not a true protein |
Species Dyadobacter fermentans [TaxId:471854] [256280] (1 PDB entry) |
Domain d4h0ca1: 4h0c A:1-207 [252353] Other proteins in same PDB: d4h0ca2, d4h0cb2 automated match to d3u0va_ complexed with cit, gol, na |
PDB Entry: 4h0c (more details), 1.62 Å
SCOPe Domain Sequences for d4h0ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h0ca1 c.69.1.0 (A:1-207) automated matches {Dyadobacter fermentans [TaxId: 471854]} mythskqiitsgvpvqrakkavvmlhgrggtaadiislqkvlkldemaiyapqatnnswy pysfmapvqqnqpaldsalalvgevvaeieaqgipaeqiyfagfsqgacltleyttrnar kyggiiaftggligqelaignykgdfkqtpvfistgnpdphvpvsrvqesvtiledmnaa vsqvvypgrphtisgdeiqlvnntilk
Timeline for d4h0ca1: