SCOPe 2.06: Domain d4h0ca1: 4h0c A:1-207

Lineage for d4h0ca1 (4h0c A:1-207)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (91 species)
   not a true protein

7. Species Dyadobacter fermentans [TaxId:471854] [256280] (1 PDB entry)

8. Domain d4h0ca1: 4h0c A:1-207 [252353]
   Other proteins in same PDB: d4h0ca2, d4h0cb2
   automated match to d3u0va_
   complexed with cit, gol, na

Details for d4h0ca1

PDB Entry: 4h0c, 1.62 Å

PDB Description: Crystal structure of phospholipase/Carboxylesterase from Dyadobacter fermentans DSM 18053

PDB Compounds: (A:) Phospholipase/Carboxylesterase

SCOPe Domain Sequences for d4h0ca1:

Sequence; same for both SEQRES and ATOM records:

>d4h0ca1 c.69.1.0 (A:1-207) automated matches {Dyadobacter fermentans [TaxId: 471854]}
mythskqiitsgvpvqrakkavvmlhgrggtaadiislqkvlkldemaiyapqatnnswy
pysfmapvqqnqpaldsalalvgevvaeieaqgipaeqiyfagfsqgacltleyttrnar
kyggiiaftggligqelaignykgdfkqtpvfistgnpdphvpvsrvqesvtiledmnaa
vsqvvypgrphtisgdeiqlvnntilk

Timeline for d4h0ca1:

• d4h0ca1 first appeared in SCOPe 2.04, called d4h0ca_
  
• d4h0ca1 was called d4h0ca_ in SCOPe 2.05
  
• d4h0ca1 appears in SCOPe 2.07
  
• d4h0ca1 appears in the current release, SCOPe 2.08