Lineage for d4gxpc_ (4gxp C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2083072Protein automated matches [190245] (11 species)
    not a true protein
  7. 2083148Species Thermotoga maritima [TaxId:243274] [256277] (1 PDB entry)
  8. 2083151Domain d4gxpc_: 4gxp C: [252351]
    automated match to d1oimb_

Details for d4gxpc_

PDB Entry: 4gxp (more details), 3 Å

PDB Description: chimeric family 1 beta-glucosidase made with non-contiguous schema
PDB Compounds: (C:) Beta-glucosidase Chimeric protein

SCOPe Domain Sequences for d4gxpc_:

Sequence, based on SEQRES records: (download)

>d4gxpc_ c.1.8.4 (C:) automated matches {Thermotoga maritima [TaxId: 243274]}
kkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwke
dieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtifhwd
lpfalqlkggllnreiadwfaeysrvlfenfgdrvknwitfneplcsaipgygsgtfapg
rqstsepwtvghnilvahgravkvfretvkdgkigivlngdftypwdaadpadkeaaerr
lefftawfadpiylgdypasmrkqlgdrlptftpeeralvhgsndfygmnhytsnyirhr
sspasaddtvgnvdvlftnkqgncigpetampwlrpcaagfrdflvwiskrygyppiyvt
engaafddvvsedgrvhdqnridylkayigamvtaveldgvnvkgyfvwslldnfewaeg
yskrfgivyvdystqkrivkdsgywysnvvknngled

Sequence, based on observed residues (ATOM records): (download)

>d4gxpc_ c.1.8.4 (C:) automated matches {Thermotoga maritima [TaxId: 243274]}
kkfpegflwgvatasyqegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwked
ieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtifhwdl
pfalqlkggllnreiadwfaeysrvlfenfgdrvknwitfneplcsaipgygsgtfapgr
qstsepwtvghnilvahgravkvfretvkdgkigivlngdftypwdaadpadkeaaerrl
efftawfadpiylgdypasmrkqlgdrlptftpeeralvhgsndfygmnhytsnyirhrs
spasaddtvgnvdvlftnkqgncigpetampwlrpcaagfrdflvwiskrygyppiyvte
ngaafddvvsedgrvhdqnridylkayigamvtaveldgvnvkgyfvwslldnfewaegy
skrfgivyvystqrivkdsgywysnvvknngled

SCOPe Domain Coordinates for d4gxpc_:

Click to download the PDB-style file with coordinates for d4gxpc_.
(The format of our PDB-style files is described here.)

Timeline for d4gxpc_: