Lineage for d4gxpa_ (4gxp A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418013Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2418178Protein automated matches [190245] (11 species)
    not a true protein
  7. 2418260Species Thermotoga maritima [TaxId:243274] [256277] (1 PDB entry)
  8. 2418261Domain d4gxpa_: 4gxp A: [252349]
    automated match to d1oimb_

Details for d4gxpa_

PDB Entry: 4gxp (more details), 3 Å

PDB Description: chimeric family 1 beta-glucosidase made with non-contiguous schema
PDB Compounds: (A:) Beta-glucosidase Chimeric protein

SCOPe Domain Sequences for d4gxpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gxpa_ c.1.8.4 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
kkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwke
dieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtifhwd
lpfalqlkggllnreiadwfaeysrvlfenfgdrvknwitfneplcsaipgygsgtfapg
rqstsepwtvghnilvahgravkvfretvkdgkigivlngdftypwdaadpadkeaaerr
lefftawfadpiylgdypasmrkqlgdrlptftpeeralvhgsndfygmnhytsnyirhr
sspasaddtvgnvdvlftnkqgncigpetampwlrpcaagfrdflvwiskrygyppiyvt
engaafddvvsedgrvhdqnridylkayigamvtaveldgvnvkgyfvwslldnfewaeg
yskrfgivyvdystqkrivkdsgywysnvvknngle

SCOPe Domain Coordinates for d4gxpa_:

Click to download the PDB-style file with coordinates for d4gxpa_.
(The format of our PDB-style files is described here.)

Timeline for d4gxpa_: