Lineage for d4gxeb_ (4gxe B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2688849Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2688957Protein Phycocyanin beta subunit [88940] (9 species)
  7. 2689018Species Thermosynechococcus vulcanus [TaxId:32053] [193917] (2 PDB entries)
  8. 2689020Domain d4gxeb_: 4gxe B: [252348]
    Other proteins in same PDB: d4gxea_
    automated match to d1jbob_
    complexed with cyc, ure

Details for d4gxeb_

PDB Entry: 4gxe (more details), 3 Å

PDB Description: T. vulcanus Phycocyanin crystallized in 4M Urea
PDB Compounds: (B:) c-phycocyanin beta subunit

SCOPe Domain Sequences for d4gxeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gxeb_ a.1.1.3 (B:) Phycocyanin beta subunit {Thermosynechococcus vulcanus [TaxId: 32053]}
mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava

SCOPe Domain Coordinates for d4gxeb_:

Click to download the PDB-style file with coordinates for d4gxeb_.
(The format of our PDB-style files is described here.)

Timeline for d4gxeb_: