SCOPe 2.08: Domain d4gxea_: 4gxe A:

Lineage for d4gxea_ (4gxe A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein Phycocyanin alpha subunit [88933] (10 species)

7. Species Synechococcus vulcanus [TaxId:32053] [88938] (8 PDB entries)

8. Domain d4gxea_: 4gxe A: [252347]
   Other proteins in same PDB: d4gxeb_
   automated match to d3o18a_
   complexed with cyc, ure

Details for d4gxea_

PDB Entry: 4gxe, 3 Å

PDB Description: T. vulcanus Phycocyanin crystallized in 4M Urea

PDB Compounds: (A:) c-phycocyanin alpha subunit

SCOPe Domain Sequences for d4gxea_:

Sequence; same for both SEQRES and ATOM records:

>d4gxea_ a.1.1.3 (A:) Phycocyanin alpha subunit {Synechococcus vulcanus [TaxId: 32053]}
mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy
qkfpytttmqgsqyastpegkakcardigyylrmityclvaggtgpmdeyliaglseins
tfdlspswyiealkyikanhgltgqaaveanayidyainals

Timeline for d4gxea_:

• d4gxea_ first appeared in SCOPe 2.04
  
• d4gxea_ appears in SCOPe 2.07