SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4gwfb3 (4gwf B:219-534)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116263Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2116264Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2116365Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 protein domains)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 2116561Protein automated matches [190252] (3 species)
    not a true protein
  7. 2116562Species Human (Homo sapiens) [TaxId:9606] [187034] (27 PDB entries)
  8. 2116577Domain d4gwfb3: 4gwf B:219-534 [252342]
    Other proteins in same PDB: d4gwfa1, d4gwfa2, d4gwfb1, d4gwfb2
    automated match to d2shpa1
    complexed with edo, gol, peg, pge; mutant

Details for d4gwfb3

PDB Entry: 4gwf (more details), 2.1 Å

PDB Description: Crystal structure of the tyrosine phosphatase SHP-2 with Y279C mutation
PDB Compounds: (B:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d4gwfb3:

Sequence, based on SEQRES records: (download)

>d4gwfb3 c.45.1.2 (B:219-534) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trinaaeiesrvrelsklaettdkvkqgfweefetlqqqeckllysrkegqrqenknknr
cknilpfdhtrvvlhdgdpnepvsdyinaniimpefetkcnnskpkksyiatqgclqntv
ndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytl
relklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvh
csagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymav
qhyietlqrrieeeqk

Sequence, based on observed residues (ATOM records): (download)

>d4gwfb3 c.45.1.2 (B:219-534) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trinaaeiesrvrelskgfweefetlqqqeckllysrkegqrqenknknrcknilpfdht
rvvlhdgdpnepvsdyinaniimpksyiatqgclqntvndfwrmvfqensrvivmttkev
ergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyhf
rtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidiir
ekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietlqrrieeeqk

SCOPe Domain Coordinates for d4gwfb3:

Click to download the PDB-style file with coordinates for d4gwfb3.
(The format of our PDB-style files is described here.)

Timeline for d4gwfb3: