![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.40: OB-fold [50198] (9 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.3: TIMP-like [50242] (3 families) ![]() |
![]() | Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins) contains an irregular alpha+beta subdomain in the C-terminal extension |
![]() | Protein TIMP-1 [50244] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50245] (3 PDB entries) |
![]() | Domain d1d2ba_: 1d2b A: [25234] |
PDB Entry: 1d2b (more details)
SCOP Domain Sequences for d1d2ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d2ba_ b.40.3.1 (A:) TIMP-1 {Human (Homo sapiens)} ctcvpphpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqalgdaadirf vytpamesvcgyfhrshnrseefliagklqdgllhittcsfvapwnslslaqrrgftkty tvgcee
Timeline for d1d2ba_: