Lineage for d4gwfa3 (4gwf A:219-535)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116263Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2116264Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2116365Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 protein domains)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 2116561Protein automated matches [190252] (3 species)
    not a true protein
  7. 2116562Species Human (Homo sapiens) [TaxId:9606] [187034] (27 PDB entries)
  8. 2116576Domain d4gwfa3: 4gwf A:219-535 [252339]
    Other proteins in same PDB: d4gwfa1, d4gwfa2, d4gwfb1, d4gwfb2
    automated match to d2shpa1
    complexed with edo, gol, peg, pge; mutant

Details for d4gwfa3

PDB Entry: 4gwf (more details), 2.1 Å

PDB Description: crystal structure of the tyrosine phosphatase shp-2 with y279c mutation
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d4gwfa3:

Sequence, based on SEQRES records: (download)

>d4gwfa3 c.45.1.2 (A:219-535) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trinaaeiesrvrelsklaettdkvkqgfweefetlqqqeckllysrkegqrqenknknr
cknilpfdhtrvvlhdgdpnepvsdyinaniimpefetkcnnskpkksyiatqgclqntv
ndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytl
relklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvh
csagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymav
qhyietlqrrieeeqks

Sequence, based on observed residues (ATOM records): (download)

>d4gwfa3 c.45.1.2 (A:219-535) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trinaaeiesrvrelskgfweefetlqqqeckllysrkegqrqenknknrcknilpfdht
rvvlhdgdpnepvsdyinaniimpekksyiatqgclqntvndfwrmvfqensrvivmttk
evergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqy
hfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidi
irekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietlqrrieeeqks

SCOPe Domain Coordinates for d4gwfa3:

Click to download the PDB-style file with coordinates for d4gwfa3.
(The format of our PDB-style files is described here.)

Timeline for d4gwfa3: