| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
| Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins) |
| Protein automated matches [190198] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186941] (51 PDB entries) |
| Domain d4guol1: 4guo L:115-311 [252336] Other proteins in same PDB: d4guoa2, d4guob2, d4guoc2, d4guod2, d4guoj2, d4guok2, d4guol2 automated match to d3vd0d_ protein/DNA complex; complexed with zn |
PDB Entry: 4guo (more details), 3.19 Å
SCOPe Domain Sequences for d4guol1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4guol1 b.2.5.2 (L:115-311) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppppgta
irampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvtgrq
svvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsfegri
cacpgrdrkadedhyre
Timeline for d4guol1: