Lineage for d4guod1 (4guo D:115-311)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377721Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2377722Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 2377884Protein automated matches [190198] (2 species)
    not a true protein
  7. 2377885Species Human (Homo sapiens) [TaxId:9606] [186941] (51 PDB entries)
  8. 2378001Domain d4guod1: 4guo D:115-311 [252332]
    Other proteins in same PDB: d4guoa2, d4guob2, d4guoc2, d4guod2, d4guoj2, d4guok2, d4guol2
    automated match to d3vd0d_
    protein/DNA complex; complexed with zn

Details for d4guod1

PDB Entry: 4guo (more details), 3.19 Å

PDB Description: structure of p73 dna binding domain complex with 12 bp dna
PDB Compounds: (D:) Tumor protein p73

SCOPe Domain Sequences for d4guod1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4guod1 b.2.5.2 (D:115-311) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppppgta
irampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvtgrq
svvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsfegri
cacpgrdrkadedhyre

SCOPe Domain Coordinates for d4guod1:

Click to download the PDB-style file with coordinates for d4guod1.
(The format of our PDB-style files is described here.)

Timeline for d4guod1: