SCOP 1.73: Domain d1uead_: 1uea D:

Lineage for d1uead_ (1uea D:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.40: OB-fold [50198] (12 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.3: TIMP-like [50242] (3 families)

5. Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins)
   contains an irregular alpha+beta subdomain in the C-terminal extension

6. Protein TIMP-1 [50244] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50245] (4 PDB entries)

8. Domain d1uead_: 1uea D: [25233]
   Other proteins in same PDB: d1ueaa_, d1ueac_
   complexed with ca, zn; mutant

Details for d1uead_

PDB Entry: 1uea, 2.8 Å

PDB Description: mmp-3/timp-1 complex

PDB Compounds: (D:) tissue inhibitor of metalloproteinase-1

SCOP Domain Sequences for d1uead_:

Sequence; same for both SEQRES and ATOM records:

>d1uead_ b.40.3.1 (D:) TIMP-1 {Human (Homo sapiens) [TaxId: 9606]}
ctcvpphpqtafcnsdlvirakfvgtpevaqttlyqryeikmtkmykgfqalgdaadirf
vytpamesvcgyfhrsharseefliagklqdgllhittcsfvapwnslslaqrrgftkty
tvgceectvfpclsipcklqsgthclwtdqllqgsekgfqsrhlaclprepglctwqslr
s

Timeline for d1uead_:

• d1uead_ first appeared (with stable ids) in SCOP 1.55
  
• d1uead_ appears in SCOP 1.71
  
• d1uead_ appears in SCOP 1.75
  
• d1uead_ appears in the current release, SCOPe 2.08