Class b: All beta proteins [48724] (141 folds) |
Fold b.40: OB-fold [50198] (10 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.3: TIMP-like [50242] (3 families) |
Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins) contains an irregular alpha+beta subdomain in the C-terminal extension |
Protein TIMP-1 [50244] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50245] (3 PDB entries) |
Domain d1uead_: 1uea D: [25233] Other proteins in same PDB: d1ueaa_, d1ueac_ complexed with ca, zn; mutant |
PDB Entry: 1uea (more details), 2.8 Å
SCOP Domain Sequences for d1uead_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uead_ b.40.3.1 (D:) TIMP-1 {Human (Homo sapiens)} ctcvpphpqtafcnsdlvirakfvgtpevaqttlyqryeikmtkmykgfqalgdaadirf vytpamesvcgyfhrsharseefliagklqdgllhittcsfvapwnslslaqrrgftkty tvgceectvfpclsipcklqsgthclwtdqllqgsekgfqsrhlaclprepglctwqslr s
Timeline for d1uead_: