Lineage for d4guoa_ (4guo A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1525229Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1525684Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 1525685Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 1525777Protein automated matches [190198] (2 species)
    not a true protein
  7. 1525778Species Human (Homo sapiens) [TaxId:9606] [186941] (39 PDB entries)
  8. 1525884Domain d4guoa_: 4guo A: [252329]
    automated match to d3vd0d_
    protein/DNA complex; complexed with zn

Details for d4guoa_

PDB Entry: 4guo (more details), 3.19 Å

PDB Description: structure of p73 dna binding domain complex with 12 bp dna
PDB Compounds: (A:) Tumor protein p73

SCOPe Domain Sequences for d4guoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4guoa_ b.2.5.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hefipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstpppp
gtairampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvt
grqsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsfe
gricacpgrdrkadedhyreq

SCOPe Domain Coordinates for d4guoa_:

Click to download the PDB-style file with coordinates for d4guoa_.
(The format of our PDB-style files is described here.)

Timeline for d4guoa_: