SCOPe 2.08: Domain d4guoa1: 4guo A:115-312

Lineage for d4guoa1 (4guo A:115-312)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein automated matches [190198] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186941] (51 PDB entries)

8. Domain d4guoa1: 4guo A:115-312 [252329]
   Other proteins in same PDB: d4guoa2, d4guob2, d4guoc2, d4guod2, d4guoj2, d4guok2, d4guol2
   automated match to d3vd0d_
   protein/DNA complex; complexed with zn

Details for d4guoa1

PDB Entry: 4guo, 3.19 Å

PDB Description: structure of p73 dna binding domain complex with 12 bp dna

PDB Compounds: (A:) Tumor protein p73

SCOPe Domain Sequences for d4guoa1:

Sequence; same for both SEQRES and ATOM records:

>d4guoa1 b.2.5.2 (A:115-312) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppppgta
irampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvtgrq
svvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsfegri
cacpgrdrkadedhyreq

Timeline for d4guoa1:

• d4guoa1 first appeared in SCOPe 2.04, called d4guoa_
  
• d4guoa1 appears in SCOPe 2.07