SCOPe 2.06: Domain d4gu7b_: 4gu7 B:

Lineage for d4gu7b_ (4gu7 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (27 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:100226] [256276] (1 PDB entry)

8. Domain d4gu7b_: 4gu7 B: [252326]
   automated match to d2gvka1
   complexed with hem, ni

Details for d4gu7b_

PDB Entry: 4gu7, 3.1 Å

PDB Description: crystal structure of dyp-type peroxidase (sco7193) from streptomyces coelicolor

PDB Compounds: (B:) Putative uncharacterized protein SCO7193

SCOPe Domain Sequences for d4gu7b_:

Sequence; same for both SEQRES and ATOM records:

>d4gu7b_ d.58.4.0 (B:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
epepqmvlspltsaaiflvvtidsggedtvrdllsdvasleravgfraqpdgrlscvtgi
gseawdrlfsgarpaglhpfreldgpvhravatpgdllfhirasrldlcfalateimgrl
rgavtpqdevhgfkyfderdmlgfvdgtenptgaaarravlvgaedpafaggsyavvqky
lhdidaweglsveaqervigrrkmtdvelsddvkpadshvaltsvtgpdgsdleilrdnm
pfgsvgreefgtyfigyartpevtetmlermflgtasaphdrildfstavtgslfftpaa
dfledlparp

Timeline for d4gu7b_:

• d4gu7b_ first appeared in SCOPe 2.04
  
• d4gu7b_ appears in SCOPe 2.05
  
• d4gu7b_ appears in SCOPe 2.07
  
• d4gu7b_ appears in the current release, SCOPe 2.08