Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
Protein automated matches [190081] (27 species) not a true protein |
Species Streptomyces coelicolor [TaxId:100226] [256276] (1 PDB entry) |
Domain d4gu7b_: 4gu7 B: [252326] automated match to d2gvka1 complexed with hem, ni |
PDB Entry: 4gu7 (more details), 3.1 Å
SCOPe Domain Sequences for d4gu7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gu7b_ d.58.4.0 (B:) automated matches {Streptomyces coelicolor [TaxId: 100226]} epepqmvlspltsaaiflvvtidsggedtvrdllsdvasleravgfraqpdgrlscvtgi gseawdrlfsgarpaglhpfreldgpvhravatpgdllfhirasrldlcfalateimgrl rgavtpqdevhgfkyfderdmlgfvdgtenptgaaarravlvgaedpafaggsyavvqky lhdidaweglsveaqervigrrkmtdvelsddvkpadshvaltsvtgpdgsdleilrdnm pfgsvgreefgtyfigyartpevtetmlermflgtasaphdrildfstavtgslfftpaa dfledlparp
Timeline for d4gu7b_: