Lineage for d4gu7a_ (4gu7 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2950158Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2950159Protein automated matches [190081] (33 species)
    not a true protein
  7. 2950511Species Streptomyces coelicolor [TaxId:100226] [256276] (1 PDB entry)
  8. 2950512Domain d4gu7a_: 4gu7 A: [252325]
    automated match to d2gvka1
    complexed with hem, ni

Details for d4gu7a_

PDB Entry: 4gu7 (more details), 3.1 Å

PDB Description: crystal structure of dyp-type peroxidase (sco7193) from streptomyces coelicolor
PDB Compounds: (A:) Putative uncharacterized protein SCO7193

SCOPe Domain Sequences for d4gu7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gu7a_ d.58.4.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
epepqmvlspltsaaiflvvtidsggedtvrdllsdvasleravgfraqpdgrlscvtgi
gseawdrlfsgarpaglhpfreldgpvhravatpgdllfhirasrldlcfalateimgrl
rgavtpqdevhgfkyfderdmlgfvdgtenptgaaarravlvgaedpafaggsyavvqky
lhdidaweglsveaqervigrrkmtdvelsddvkpadshvaltsvtgpdgsdleilrdnm
pfgsvgreefgtyfigyartpevtetmlermflgtasaphdrildfstavtgslfftpaa
dfledlparp

SCOPe Domain Coordinates for d4gu7a_:

Click to download the PDB-style file with coordinates for d4gu7a_.
(The format of our PDB-style files is described here.)

Timeline for d4gu7a_: