Lineage for d4gr2b_ (4gr2 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739026Fold a.280: RbcX-like [158614] (1 superfamily)
    5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer
  4. 2739027Superfamily a.280.1: RbcX-like [158615] (2 families) (S)
  5. 2739092Family a.280.1.0: automated matches [191655] (1 protein)
    not a true family
  6. 2739093Protein automated matches [191222] (3 species)
    not a true protein
  7. 2739101Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [256275] (2 PDB entries)
  8. 2739105Domain d4gr2b_: 4gr2 B: [252324]
    automated match to d2peik_

Details for d4gr2b_

PDB Entry: 4gr2 (more details), 2 Å

PDB Description: Structure of AtRbcX1 from Arabidopsis thaliana.
PDB Compounds: (B:) AtRbcX1

SCOPe Domain Sequences for d4gr2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gr2b_ a.280.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
vpgfgeaspeakaakhlhdfftyvavrivsaqlesynpeaymelrefldtnsvsdgdkfl
atlmrrssrhmnlalrilevrsayakndfewdnmkrlafknvddsntrlmreyvlets

SCOPe Domain Coordinates for d4gr2b_:

Click to download the PDB-style file with coordinates for d4gr2b_.
(The format of our PDB-style files is described here.)

Timeline for d4gr2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4gr2a_