SCOPe 2.08: Domain d4gq9l1: 4gq9 L:1-109

Lineage for d4gq9l1 (4gq9 L:1-109)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4gq9l1: 4gq9 L:1-109 [252293]
   Other proteins in same PDB: d4gq9h1, d4gq9h2, d4gq9l2
   automated match to d3eotl1

Details for d4gq9l1

PDB Entry: 4gq9, 3 Å

PDB Description: chikungunya virus neutralizing antibody 9.8b fab fragment

PDB Compounds: (L:) Chikungunya virus neutralizing antibody 9.8B Fab fragment light chain

SCOPe Domain Sequences for d4gq9l1:

Sequence; same for both SEQRES and ATOM records:

>d4gq9l1 b.1.1.0 (L:1-109) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qivltqspaimsaspgekvtmtcsasssvtymywyqqkpgssprlliydtsnlasgvpvr
fsgsgsgtsysltisrmeaedaatyycqqrtnypltfgagtklelkrad

Timeline for d4gq9l1:

• d4gq9l1 first appeared in SCOPe 2.04
  
• d4gq9l1 appears in SCOPe 2.07