| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
| Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
| Protein Cbl [55587] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [55588] (12 PDB entries) |
| Domain d4gplb3: 4gpl B:264-351 [252292] Other proteins in same PDB: d4gplb1, d4gplb2 automated match to d1b47a3 |
PDB Entry: 4gpl (more details), 3 Å
SCOPe Domain Sequences for d4gplb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gplb3 d.93.1.1 (B:264-351) Cbl {Human (Homo sapiens) [TaxId: 9606]}
thpgymafltydevkarlqkfihkpgsyifrlsctrlgqwaigyvtadgnilqtiphnkp
lfqalidgfregfylfpdgrnqnpdltg
Timeline for d4gplb3: