Lineage for d4gplb1 (4gpl B:47-177)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714566Fold a.48: N-cbl like [47667] (5 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 2714567Superfamily a.48.1: N-terminal domain of cbl (N-cbl) [47668] (2 families) (S)
    automatically mapped to Pfam PF02262
  5. 2714568Family a.48.1.1: N-terminal domain of cbl (N-cbl) [47669] (1 protein)
  6. 2714569Protein N-terminal domain of cbl (N-cbl) [47670] (1 species)
  7. 2714570Species Human (Homo sapiens) [TaxId:9606] [47671] (13 PDB entries)
  8. 2714589Domain d4gplb1: 4gpl B:47-177 [252290]
    Other proteins in same PDB: d4gplb2, d4gplb3
    automated match to d2cbla2

Details for d4gplb1

PDB Entry: 4gpl (more details), 3 Å

PDB Description: Structure of Cbl(TKB) bound to a phosphorylated pentapeptide
PDB Compounds: (B:) E3 ubiquitin-protein ligase CBL

SCOPe Domain Sequences for d4gplb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gplb1 a.48.1.1 (B:47-177) N-terminal domain of cbl (N-cbl) {Human (Homo sapiens) [TaxId: 9606]}
ppgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsryegkm
etlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmlaelk
gifpsglfqgd

SCOPe Domain Coordinates for d4gplb1:

Click to download the PDB-style file with coordinates for d4gplb1.
(The format of our PDB-style files is described here.)

Timeline for d4gplb1: