Lineage for d1fnwf1 (1fnw F:1501-1607)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 228613Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 228945Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 228997Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
  7. 228998Species Streptococcus pyogenes [TaxId:1314] [50241] (7 PDB entries)
  8. 229024Domain d1fnwf1: 1fnw F:1501-1607 [25229]
    Other proteins in same PDB: d1fnwa2, d1fnwb2, d1fnwc2, d1fnwd2, d1fnwe2, d1fnwf2, d1fnwg2, d1fnwh2

Details for d1fnwf1

PDB Entry: 1fnw (more details), 3.9 Å

PDB Description: crystal structure of streptococcal pyrogenic exotoxin a

SCOP Domain Sequences for d1fnwf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnwf1 b.40.2.2 (F:1501-1607) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

SCOP Domain Coordinates for d1fnwf1:

Click to download the PDB-style file with coordinates for d1fnwf1.
(The format of our PDB-style files is described here.)

Timeline for d1fnwf1: