![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
![]() | Protein automated matches [227126] (15 species) not a true protein |
![]() | Species Pseudomonas putida [TaxId:303] [254984] (35 PDB entries) |
![]() | Domain d4gpea3: 4gpe A:342-526 [252289] Other proteins in same PDB: d4gpea2 automated match to d1q6za3 complexed with ca, gol, na, tzd; mutant |
PDB Entry: 4gpe (more details), 1.39 Å
SCOPe Domain Sequences for d4gpea3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gpea3 c.36.1.0 (A:342-526) automated matches {Pseudomonas putida [TaxId: 303]} epakvdqdagrlhpetvfdtlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaag gmgfalpaaigvqlaeperqviavigdgsanysisalwtaaqyniptifvimnngtygal rwfagvleaenvpgldvpgidfralakgygvqalkadnleqlkgslqealsakgpvliev stvsp
Timeline for d4gpea3: