Lineage for d4gp3a2 (4gp3 A:141-259)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543030Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1543871Superfamily b.42.5: Actin-crosslinking proteins [50405] (2 families) (S)
  5. 1543872Family b.42.5.1: Fascin [50406] (1 protein)
    automatically mapped to Pfam PF06268
  6. 1543873Protein Fascin [50407] (1 species)
    duplication: tandem repeat of four domains
  7. 1543874Species Human (Homo sapiens) [TaxId:9606] [50408] (6 PDB entries)
  8. 1543892Domain d4gp3a2: 4gp3 A:141-259 [252277]
    automated match to d3llpa2
    complexed with br, cl, gol; mutant

Details for d4gp3a2

PDB Entry: 4gp3 (more details), 2.25 Å

PDB Description: The crystal structure of human fascin 1 K358A mutant
PDB Compounds: (A:) fascin

SCOPe Domain Sequences for d4gp3a2:

Sequence, based on SEQRES records: (download)

>d4gp3a2 b.42.5.1 (A:141-259) Fascin {Human (Homo sapiens) [TaxId: 9606]}
qvniysvtrkryahlsarpadeiavdrdvpwgvdslitlafqdqrysvqtadhrflrhdg
rlvarpepatgytlefrsgkvafrdcegrylapsgpsgtlkagkatkvgkdelfaleqs

Sequence, based on observed residues (ATOM records): (download)

>d4gp3a2 b.42.5.1 (A:141-259) Fascin {Human (Homo sapiens) [TaxId: 9606]}
qvniysvtrkryahlsaadeiavdrdvpwgvdslitlafqdqrysvqtadhrflrhdgrl
varpepatgytlefrsgkvafrdcegrylapsgpsgtlkagkatkvgkdelfaleqs

SCOPe Domain Coordinates for d4gp3a2:

Click to download the PDB-style file with coordinates for d4gp3a2.
(The format of our PDB-style files is described here.)

Timeline for d4gp3a2: