Lineage for d4goya1 (4goy A:7-140)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2062436Superfamily b.42.5: Actin-crosslinking proteins [50405] (3 families) (S)
  5. 2062437Family b.42.5.1: Fascin [50406] (1 protein)
    automatically mapped to Pfam PF06268
  6. 2062438Protein Fascin [50407] (1 species)
    duplication: tandem repeat of four domains
  7. 2062439Species Human (Homo sapiens) [TaxId:9606] [50408] (8 PDB entries)
  8. 2062472Domain d4goya1: 4goy A:7-140 [252260]
    automated match to d3llpb1
    complexed with br, cl, dtt, gol; mutant

Details for d4goya1

PDB Entry: 4goy (more details), 2.3 Å

PDB Description: The crystal structure of human fascin 1 K41A mutant
PDB Compounds: (A:) fascin

SCOPe Domain Sequences for d4goya1:

Sequence, based on SEQRES records: (download)

>d4goya1 b.42.5.1 (A:7-140) Fascin {Human (Homo sapiens) [TaxId: 9606]}
aeavqiqfglincgnkyltaeafgfkvnasasslakkqiwtleqppdeagsaavclrshl
grylaadkdgnvtcerevpgpdcrflivahddgrwslqseahrryfggtedrlscfaqtv
spaekwsvhiamhp

Sequence, based on observed residues (ATOM records): (download)

>d4goya1 b.42.5.1 (A:7-140) Fascin {Human (Homo sapiens) [TaxId: 9606]}
aeavqiqfglincgnkyltaeafgfkvnasasslakkqiwtleqppagsaavclrshlgr
ylaadkdgnvtcerevpgpdcrflivahddgrwslqseahrryfggtedrlscfaqtvsp
aekwsvhiamhp

SCOPe Domain Coordinates for d4goya1:

Click to download the PDB-style file with coordinates for d4goya1.
(The format of our PDB-style files is described here.)

Timeline for d4goya1: