Class b: All beta proteins [48724] (180 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.5: Actin-crosslinking proteins [50405] (3 families) |
Family b.42.5.1: Fascin [50406] (1 protein) automatically mapped to Pfam PF06268 |
Protein Fascin [50407] (1 species) duplication: tandem repeat of four domains |
Species Human (Homo sapiens) [TaxId:9606] [50408] (18 PDB entries) |
Domain d4govb4: 4gov B:383-493 [252259] automated match to d3llpa4 complexed with br, cl, dtt, gol; mutant |
PDB Entry: 4gov (more details), 2.2 Å
SCOPe Domain Sequences for d4govb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4govb4 b.42.5.1 (B:383-493) Fascin {Human (Homo sapiens) [TaxId: 9606]} rpiivfrgehgfigcrkvtgtldanrssydvfqlefndgaynikdstgkywtvgsdsavt ssgdtpvdfffefcdynkvaikvggrylkgdhagvlkasaetvdpaslwey
Timeline for d4govb4:
View in 3D Domains from other chains: (mouse over for more information) d4gova1, d4gova2, d4gova3, d4gova4 |