SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4govb4 (4gov B:383-493)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2053108Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2054015Superfamily b.42.5: Actin-crosslinking proteins [50405] (3 families) (S)
  5. 2054016Family b.42.5.1: Fascin [50406] (1 protein)
    automatically mapped to Pfam PF06268
  6. 2054017Protein Fascin [50407] (1 species)
    duplication: tandem repeat of four domains
  7. 2054018Species Human (Homo sapiens) [TaxId:9606] [50408] (8 PDB entries)
  8. 2054034Domain d4govb4: 4gov B:383-493 [252259]
    automated match to d3llpa4
    complexed with br, cl, dtt, gol; mutant

Details for d4govb4

PDB Entry: 4gov (more details), 2.2 Å

PDB Description: The crystal structure of human fascin 1 S39D mutant
PDB Compounds: (B:) fascin

SCOPe Domain Sequences for d4govb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4govb4 b.42.5.1 (B:383-493) Fascin {Human (Homo sapiens) [TaxId: 9606]}
rpiivfrgehgfigcrkvtgtldanrssydvfqlefndgaynikdstgkywtvgsdsavt
ssgdtpvdfffefcdynkvaikvggrylkgdhagvlkasaetvdpaslwey

SCOPe Domain Coordinates for d4govb4:

Click to download the PDB-style file with coordinates for d4govb4.
(The format of our PDB-style files is described here.)

Timeline for d4govb4: