Lineage for d1fnwa1 (1fnw A:1-107)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558996Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 559069Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 559492Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)
  6. 559558Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
  7. 559559Species Streptococcus pyogenes [TaxId:1314] [50241] (8 PDB entries)
  8. 559584Domain d1fnwa1: 1fnw A:1-107 [25224]
    Other proteins in same PDB: d1fnwa2, d1fnwb2, d1fnwc2, d1fnwd2, d1fnwe2, d1fnwf2, d1fnwg2, d1fnwh2

Details for d1fnwa1

PDB Entry: 1fnw (more details), 3.9 Å

PDB Description: crystal structure of streptococcal pyrogenic exotoxin a

SCOP Domain Sequences for d1fnwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnwa1 b.40.2.2 (A:1-107) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

SCOP Domain Coordinates for d1fnwa1:

Click to download the PDB-style file with coordinates for d1fnwa1.
(The format of our PDB-style files is described here.)

Timeline for d1fnwa1: