Lineage for d4gmda_ (4gmd A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114605Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [226294] (11 PDB entries)
  8. 2114613Domain d4gmda_: 4gmd A: [252234]
    automated match to d3uwob_
    complexed with atm, ca, cl, gol

Details for d4gmda_

PDB Entry: 4gmd (more details), 1.98 Å

PDB Description: The crystal structure of thymidylate kinase from Pseudomonas aeruginosa PAO1 in complex with AZT Monophosphate
PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d4gmda_:

Sequence, based on SEQRES records: (download)

>d4gmda_ c.37.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
tglfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllapsdepm
aadtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaales
fvqgdlrpdltlvfdlpveiglaraaargrldrfeqedrrffeavrqtylqraaqapery
qvldaglplaevqagldrllpnllerln

Sequence, based on observed residues (ATOM records): (download)

>d4gmda_ c.37.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
tglfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllapsdepm
aadtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaales
fvqgdlrpdltlvfdlpveigargrldrfeqedrrffeavrqtylqraaqaperyqvlda
glplaevqagldrllpnllerln

SCOPe Domain Coordinates for d4gmda_:

Click to download the PDB-style file with coordinates for d4gmda_.
(The format of our PDB-style files is described here.)

Timeline for d4gmda_: