Lineage for d1fnvd1 (1fnv D:901-1007)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 13632Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 13929Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)
  6. 13969Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
  7. 13970Species Streptococcus pyogenes [TaxId:1314] [50241] (4 PDB entries)
  8. 13982Domain d1fnvd1: 1fnv D:901-1007 [25223]
    Other proteins in same PDB: d1fnva2, d1fnvb2, d1fnvc2, d1fnvd2

Details for d1fnvd1

PDB Entry: 1fnv (more details), 3.6 Å

PDB Description: structure of streptococcal pyrogenic exotoxin a

SCOP Domain Sequences for d1fnvd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnvd1 b.40.2.2 (D:901-1007) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

SCOP Domain Coordinates for d1fnvd1:

Click to download the PDB-style file with coordinates for d1fnvd1.
(The format of our PDB-style files is described here.)

Timeline for d1fnvd1: