Lineage for d4gkae_ (4gka E:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1860688Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1860705Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1860706Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 1861402Protein automated matches [190142] (18 species)
    not a true protein
  7. 1861452Species Human (Homo sapiens) [TaxId:9606] [256021] (5 PDB entries)
  8. 1861460Domain d4gkae_: 4gka E: [252223]
    automated match to d1ulba_
    complexed with gol, po4; mutant

Details for d4gkae_

PDB Entry: 4gka (more details), 2.2 Å

PDB Description: crystal structure of purine nucleoside phosphorylase (w16y, w94y, w178y, h257w) mutant from human complexed with phosphate
PDB Compounds: (E:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d4gkae_:

Sequence, based on SEQRES records: (download)

>d4gkae_ c.56.2.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ngytyedykntaeyllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprstvp
ghagrlvfgflngracvmmqgrfhmyegyplykvtfpvrvfhllgvdtlvvtnaagglnp
kfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstykqmg
eqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfslit
nkvimdyeslekanweevlaagkqaaqkleqfvsilmasiplp

Sequence, based on observed residues (ATOM records): (download)

>d4gkae_ c.56.2.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ngytyedykntaeyllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprstvp
ghagrlvfgflngracvmmqgrfhmyegyplykvtfpvrvfhllgvdtlvvtnaagglnp
kfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstykqmg
eqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfslit
nkvimdyqaaqkleqfvsilmasiplp

SCOPe Domain Coordinates for d4gkae_:

Click to download the PDB-style file with coordinates for d4gkae_.
(The format of our PDB-style files is described here.)

Timeline for d4gkae_: