Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
Protein automated matches [190142] (19 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [256021] (7 PDB entries) |
Domain d4gkac_: 4gka C: [252221] automated match to d1ulba_ complexed with gol, po4; mutant |
PDB Entry: 4gka (more details), 2.2 Å
SCOPe Domain Sequences for d4gkac_:
Sequence, based on SEQRES records: (download)
>d4gkac_ c.56.2.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gytyedykntaeyllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprstvpg hagrlvfgflngracvmmqgrfhmyegyplykvtfpvrvfhllgvdtlvvtnaagglnpk fevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstykqmge qrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfslitn kvimdyeslekanweevlaagkqaaqkleqfvsilmasiplp
>d4gkac_ c.56.2.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gytyedykntaeyllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprstvpg hagrlvfgflngracvmmqgrfhmyegyplykvtfpvrvfhllgvdtlvvtnaagglnpk fevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstykqmge qrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfslitn kvimdyqaaqkleqfvsilmasiplp
Timeline for d4gkac_: