Lineage for d4gkab_ (4gka B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2887828Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2888641Protein automated matches [190142] (21 species)
    not a true protein
  7. 2888689Species Human (Homo sapiens) [TaxId:9606] [256021] (7 PDB entries)
  8. 2888694Domain d4gkab_: 4gka B: [252220]
    automated match to d1ulba_
    complexed with gol, po4; mutant

Details for d4gkab_

PDB Entry: 4gka (more details), 2.2 Å

PDB Description: crystal structure of purine nucleoside phosphorylase (w16y, w94y, w178y, h257w) mutant from human complexed with phosphate
PDB Compounds: (B:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d4gkab_:

Sequence, based on SEQRES records: (download)

>d4gkab_ c.56.2.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
engytyedykntaeyllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprstv
pghagrlvfgflngracvmmqgrfhmyegyplykvtfpvrvfhllgvdtlvvtnaaggln
pkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstykqm
geqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfsli
tnkvimdyeslekanweevlaagkqaaqkleqfvsilmasiplp

Sequence, based on observed residues (ATOM records): (download)

>d4gkab_ c.56.2.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
engytyedykntaeyllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprstv
pghagrlvfgflngracvmmqgrfhmyegyplykvtfpvrvfhllgvdtlvvtnaaggln
pkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstykqm
geqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfsli
tnkvimdyeqaaqkleqfvsilmasiplp

SCOPe Domain Coordinates for d4gkab_:

Click to download the PDB-style file with coordinates for d4gkab_.
(The format of our PDB-style files is described here.)

Timeline for d4gkab_: