SCOPe 2.06: Domain d4gh4a_: 4gh4 A:

Lineage for d4gh4a_ (4gh4 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein automated matches [190854] (15 species)
   not a true protein

7. Species Foot-and-mouth disease virus - type a [TaxId:12111] [196861] (4 PDB entries)

8. Domain d4gh4a_: 4gh4 A: [252214]
   automated match to d4iv1a_

Details for d4gh4a_

PDB Entry: 4gh4, 3 Å

PDB Description: Crystal Structure of Foot and Mouth Disease Virus A22 Serotype

PDB Compounds: (A:) Capsid protein VP1

SCOPe Domain Sequences for d4gh4a_:

Sequence, based on SEQRES records:

>d4gh4a_ b.121.4.1 (A:) automated matches {Foot-and-mouth disease virus - type a [TaxId: 12111]}
ttttgesadpvtttvenyggetqvqrrqhtdvtfimdrfvkiqnlnpthvidlmqthqhg
lvgallraatyyfsdleivvrhdgnltwvpngapeaalsntgnptaylkapftrlalpyt
aphrvlatvyngtskysaggtgrrgdlgplaarvaaqlpasfnfgaiqattihellvrmk
raelycprpllavevssqdrhkqkiiapak

Sequence, based on observed residues (ATOM records):

>d4gh4a_ b.121.4.1 (A:) automated matches {Foot-and-mouth disease virus - type a [TaxId: 12111]}
ttttgesadpvtttvenyggetqvqrrqhtdvtfimdrfvkiqnlnpthvidlmqthqhg
lvgallraatyyfsdleivvrhdgnltwvpngapeaalsntgnptaylkapftrlalpyt
aphrvlatvyngtskyaqlpasfnfgaiqattihellvrmkraelycprpllavevssqd
rhkqkiiapak

Timeline for d4gh4a_:

• d4gh4a_ first appeared in SCOPe 2.04
  
• d4gh4a_ appears in SCOPe 2.05
  
• d4gh4a_ appears in SCOPe 2.07
  
• d4gh4a_ appears in the current release, SCOPe 2.08