SCOPe 2.05: Domain d4ggba2: 4ggb A:124-374

Lineage for d4ggba2 (4ggb A:124-374)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (71 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [256273] (2 PDB entries)

8. Domain d4ggba2: 4ggb A:124-374 [252213]
   Other proteins in same PDB: d4ggba1
   automated match to d3sjna2
   complexed with ca, cl

Details for d4ggba2

PDB Entry: 4ggb, 2 Å

PDB Description: crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, disordered loops

PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d4ggba2:

Sequence, based on SEQRES records:

>d4ggba2 c.1.11.0 (A:124-374) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
rwresvrayatgsfkrdnvdrvsdnasemaerraegfhackikigfgveedlrviaavre
aigpdmrlmidanhgytvteaitlgdraagfgidwfeepvvpeqldayarvragqpipva
ggetwhgrygmwqalsagavdilqpdlcgcggfseiqkiatlatlhgvrivphvwgtgvq
iaaalqfmaamtpdpvrvnpiepimefdrthnpfrqavlrepleavngvvtipdgpglgi
einrdaltefr

Sequence, based on observed residues (ATOM records):

>d4ggba2 c.1.11.0 (A:124-374) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
rwresvrayatgdrvsdnasemaerraegfhackikigfgveedlrviaavreaigpdmr
lmidanhgytvteaitlgdraagfgidwfeepvvpeqldayarvragqpipvaggetwhg
rygmwqalsagavdilqpdlcgcggfseiqkiatlatlhgvrivphvwgtgvqiaaalqf
maamtpdpvrvnpiepimefdrthnpfrqavlrepleavngvvtipdgpglgieinrdal
tefr

Timeline for d4ggba2:

• d4ggba2 first appeared in SCOPe 2.04
  
• d4ggba2 appears in SCOPe 2.06
  
• d4ggba2 appears in the current release, SCOPe 2.08