Lineage for d4ggba2 (4ggb A:124-374)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2086988Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2087392Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2087393Protein automated matches [226923] (73 species)
    not a true protein
  7. 2087407Species Agrobacterium tumefaciens [TaxId:176299] [256273] (2 PDB entries)
  8. 2087409Domain d4ggba2: 4ggb A:124-374 [252213]
    Other proteins in same PDB: d4ggba1
    automated match to d3sjna2
    complexed with ca, cl

Details for d4ggba2

PDB Entry: 4ggb (more details), 2 Å

PDB Description: crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, disordered loops
PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d4ggba2:

Sequence, based on SEQRES records: (download)

>d4ggba2 c.1.11.0 (A:124-374) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
rwresvrayatgsfkrdnvdrvsdnasemaerraegfhackikigfgveedlrviaavre
aigpdmrlmidanhgytvteaitlgdraagfgidwfeepvvpeqldayarvragqpipva
ggetwhgrygmwqalsagavdilqpdlcgcggfseiqkiatlatlhgvrivphvwgtgvq
iaaalqfmaamtpdpvrvnpiepimefdrthnpfrqavlrepleavngvvtipdgpglgi
einrdaltefr

Sequence, based on observed residues (ATOM records): (download)

>d4ggba2 c.1.11.0 (A:124-374) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
rwresvrayatgdrvsdnasemaerraegfhackikigfgveedlrviaavreaigpdmr
lmidanhgytvteaitlgdraagfgidwfeepvvpeqldayarvragqpipvaggetwhg
rygmwqalsagavdilqpdlcgcggfseiqkiatlatlhgvrivphvwgtgvqiaaalqf
maamtpdpvrvnpiepimefdrthnpfrqavlrepleavngvvtipdgpglgieinrdal
tefr

SCOPe Domain Coordinates for d4ggba2:

Click to download the PDB-style file with coordinates for d4ggba2.
(The format of our PDB-style files is described here.)

Timeline for d4ggba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ggba1