Lineage for d4gekg_ (4gek G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893217Family c.66.1.14: Hypothetical protein HI0319 (YecO) [69544] (2 proteins)
  6. 2893222Protein automated matches [197190] (2 species)
    not a true protein
  7. 2893223Species Escherichia coli [TaxId:511145] [256272] (1 PDB entry)
  8. 2893225Domain d4gekg_: 4gek G: [252207]
    automated match to d4iwna_
    complexed with gek, so4

Details for d4gekg_

PDB Entry: 4gek (more details), 1.5 Å

PDB Description: crystal structure of wild-type cmoa from e.coli
PDB Compounds: (G:) tRNA (cmo5U34)-methyltransferase

SCOPe Domain Sequences for d4gekg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gekg_ c.66.1.14 (G:) automated matches {Escherichia coli [TaxId: 511145]}
lgdwtfdervaevfpdmiqrsvpgysniismigmlaerfvqpgtqvydlgcslgaatlsv
rrnihhdnckiiaidnspamiercrrhidaykaptpvdviegdirdiaienasmvvlnft
lqflepserqalldkiyqglnpggalvlsekfsfedakvgellfnmhhdfkrangysele
isqkrsmlenvmltdsvethkarlhkagfehselwfqcfnfgslvalkaed

SCOPe Domain Coordinates for d4gekg_:

Click to download the PDB-style file with coordinates for d4gekg_.
(The format of our PDB-style files is described here.)

Timeline for d4gekg_: