SCOPe 2.07: Domain d4gekg_: 4gek G:

Lineage for d4gekg_ (4gek G:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.14: Hypothetical protein HI0319 (YecO) [69544] (2 protein domains)

6. Protein automated matches [197190] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:511145] [256272] (1 PDB entry)

8. Domain d4gekg_: 4gek G: [252207]
   automated match to d4iwna_
   complexed with gek, so4

Details for d4gekg_

PDB Entry: 4gek, 1.5 Å

PDB Description: crystal structure of wild-type cmoa from e.coli

PDB Compounds: (G:) tRNA (cmo5U34)-methyltransferase

SCOPe Domain Sequences for d4gekg_:

Sequence; same for both SEQRES and ATOM records:

>d4gekg_ c.66.1.14 (G:) automated matches {Escherichia coli [TaxId: 511145]}
lgdwtfdervaevfpdmiqrsvpgysniismigmlaerfvqpgtqvydlgcslgaatlsv
rrnihhdnckiiaidnspamiercrrhidaykaptpvdviegdirdiaienasmvvlnft
lqflepserqalldkiyqglnpggalvlsekfsfedakvgellfnmhhdfkrangysele
isqkrsmlenvmltdsvethkarlhkagfehselwfqcfnfgslvalkaed

Timeline for d4gekg_:

• d4gekg_ first appeared in SCOPe 2.04
  
• d4gekg_ appears in SCOPe 2.06