![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies) core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta |
![]() | Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (2 families) ![]() automatically mapped to Pfam PF01765 |
![]() | Family d.67.3.0: automated matches [227278] (1 protein) not a true family |
![]() | Protein automated matches [227087] (3 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [256271] (1 PDB entry) |
![]() | Domain d4gd1y_: 4gd1 Y: [252203] complexed with mg complexed with mg |
PDB Entry: 4gd1 (more details), 3 Å
SCOPe Domain Sequences for d4gd1y_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gd1y_ d.67.3.0 (Y:) automated matches {Escherichia coli K-12 [TaxId: 83333]} gisdirkdaevrmdkcveafktqiskirtgraspslldgivveyygtptplrqlasvtve dsrtlkinvfdrsmspavekaimasdlglnpnsagsdirvplpplteerrkdltkivrge aeqarvavrnvrrdandkvkallkdkeisedddrrsqddvqkltdaaikkieaaladkea elm
Timeline for d4gd1y_: