Lineage for d4gd1y_ (4gd1 Y:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1912596Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 1912641Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (2 families) (S)
    automatically mapped to Pfam PF01765
  5. 1912675Family d.67.3.0: automated matches [227278] (1 protein)
    not a true family
  6. 1912676Protein automated matches [227087] (3 species)
    not a true protein
  7. 1912679Species Escherichia coli K-12 [TaxId:83333] [256271] (1 PDB entry)
  8. 1912680Domain d4gd1y_: 4gd1 Y: [252203]
    complexed with mg
    complexed with mg

Details for d4gd1y_

PDB Entry: 4gd1 (more details), 3 Å

PDB Description: Structures of the bacterial ribosome in classical and hybrid states of tRNA binding
PDB Compounds: (Y:) ribosome recycling factor

SCOPe Domain Sequences for d4gd1y_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gd1y_ d.67.3.0 (Y:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
gisdirkdaevrmdkcveafktqiskirtgraspslldgivveyygtptplrqlasvtve
dsrtlkinvfdrsmspavekaimasdlglnpnsagsdirvplpplteerrkdltkivrge
aeqarvavrnvrrdandkvkallkdkeisedddrrsqddvqkltdaaikkieaaladkea
elm

SCOPe Domain Coordinates for d4gd1y_:

Click to download the PDB-style file with coordinates for d4gd1y_.
(The format of our PDB-style files is described here.)

Timeline for d4gd1y_: