Lineage for d4gcvf_ (4gcv F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694988Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [256270] (3 PDB entries)
  8. 2694995Domain d4gcvf_: 4gcv F: [252196]
    automated match to d2f2eb_
    complexed with gol, na, po4

Details for d4gcvf_

PDB Entry: 4gcv (more details), 2.3 Å

PDB Description: Structure of a Putative transcription factor (PA1374)from Pseudomonas aeruginosa
PDB Compounds: (F:) Putative transcription protein

SCOPe Domain Sequences for d4gcvf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gcvf_ a.4.5.0 (F:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
cpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnalveagllerqp
ysqrplryqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgrpvrsfmaala
dgrtvpleqctvqagpaaseemrqrl

SCOPe Domain Coordinates for d4gcvf_:

Click to download the PDB-style file with coordinates for d4gcvf_.
(The format of our PDB-style files is described here.)

Timeline for d4gcvf_: