Lineage for d4gawc_ (4gaw C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1545555Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1547083Protein automated matches [190044] (14 species)
    not a true protein
  7. 1547122Species Human (Homo sapiens) [TaxId:9606] [187233] (136 PDB entries)
  8. 1547275Domain d4gawc_: 4gaw C: [252175]
    automated match to d3tk9a_
    complexed with cl, so4

Details for d4gawc_

PDB Entry: 4gaw (more details), 3 Å

PDB Description: Crystal structure of active human granzyme H
PDB Compounds: (C:) Granzyme H

SCOPe Domain Sequences for d4gawc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gawc_ b.47.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iiggheakphsrpymafvqflqeksrkrcggilvrkdfvltaahcqgssinvtlgahnik
eqertqqfipvkrpiphpaynpknfsndimllqlerkakwttavrplrlpsskaqvkpgq
lcsvagwgyvsmstlattlqevlltvqkdcqcerlfhgnysrateicvgdpkktqtgfkg
dsggplvckdvaqgilsygnkkgtppgvyikvshflpwikrtmkrl

SCOPe Domain Coordinates for d4gawc_:

Click to download the PDB-style file with coordinates for d4gawc_.
(The format of our PDB-style files is described here.)

Timeline for d4gawc_: