Lineage for d4gaaa1 (4gaa A:2-205)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2085522Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2085523Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2085607Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. 2085608Protein automated matches [254706] (5 species)
    not a true protein
  7. 2085609Species African clawed frog (Xenopus laevis) [TaxId:8355] [256266] (1 PDB entry)
  8. 2085610Domain d4gaaa1: 4gaa A:2-205 [252167]
    Other proteins in same PDB: d4gaaa2, d4gaaa3, d4gaab2, d4gaab3
    automated match to d2vj8a2
    complexed with bes, zn

Details for d4gaaa1

PDB Entry: 4gaa (more details), 2.26 Å

PDB Description: Structure of Leukotriene A4 hydrolase from Xenopus laevis complexed with inhibitor bestatin
PDB Compounds: (A:) MGC78867 protein

SCOPe Domain Sequences for d4gaaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gaaa1 b.98.1.0 (A:2-205) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
adpssfaspekfnikhmhlklhvdftsraiaastsltvrslqdslaslildtkdltikkv
avngkdatfalgtthsfkgtpleitlpfsltrgqeviveidsvtspkssalqwlnkeqta
gkihpylfsqcqathcrsiipcqdtpsvkftyysqvsvpkelmalmsalrdgelseqsds
nrkiyrfkqnvpipsylialvvga

SCOPe Domain Coordinates for d4gaaa1:

Click to download the PDB-style file with coordinates for d4gaaa1.
(The format of our PDB-style files is described here.)

Timeline for d4gaaa1: