SCOPe 2.04: Domain d4g8xa_: 4g8x A:

Lineage for d4g8xa_ (4g8x A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families)

5. Family a.4.13.2: Sigma4 domain [88665] (5 proteins)

6. Protein automated matches [193280] (1 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93061] [193281] (3 PDB entries)

8. Domain d4g8xa_: 4g8x A: [252163]
   automated match to d4g6da_
   protein/DNA complex; protein/RNA complex

Details for d4g8xa_

PDB Entry: 4g8x, 3 Å

PDB Description: G1 ORF67 / Staphyloccus aureus sigmaA domain 4 complex

PDB Compounds: (A:) RNA polymerase sigma factor rpoD

SCOPe Domain Sequences for d4g8xa_:

Sequence; same for both SEQRES and ATOM records:

>d4g8xa_ a.4.13.2 (A:) automated matches {Staphylococcus aureus [TaxId: 93061]}
mkeqledvldtltdreenvlrlrfglddgrtrtleevgkvfgvtrerirqieakalrklr
h

Timeline for d4g8xa_:

• d4g8xa_ is new in SCOPe 2.04-stable
  
• d4g8xa_ appears in SCOPe 2.05
  
• d4g8xa_ appears in the current release, SCOPe 2.08